Proteintech, 30691-1-AP, CD86 Polyclonal antibody

Size: 20ul / 150ul The CD86 (30691-1-AP) by Proteintech is a Polyclonal antibody targeting CD86 in WB, ELISA applications with reactivity to mouse, rat samples 30691-1-AP targets CD86 in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: DC2.4 cells, NR8383 cells, J774A.1 cells, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335) Specification Tested Reactivity: mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33514 Product name: Recombinant mouse Cd86 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-244 aa of NM_019388 Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWK Predict reactive species Full Name: CD86 antigen Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_019388 Gene Symbol: Cd86 Gene ID (NCBI): 12524 RRID: AB_3086387 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42082-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.