Iright
BRAND / VENDOR: Proteintech

Proteintech, 30716-1-AP, MAP4K3 Polyclonal antibody

CATALOG NUMBER: 30716-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MAP4K3 (30716-1-AP) by Proteintech is a Polyclonal antibody targeting MAP4K3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30716-1-AP targets MAP4K3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-87 MG cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MAP4K3(Mitogen-activated protein kinase kinase kinase kinase 3) has kinase activity and that it activates JNK but not MAPK1, MAPK3 or MAPK14 through the activation of MAP3K1 and MAP2K4. Endogenous MAP4K3 kinase activity could be stimulated by exposure to ultraviolet radiation or to tumor necrosis factor. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33512 Product name: Recombinant human MAP4K3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 345-515 aa of BC071579 Sequence: ETEPHHELDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGL Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase kinase 3 Calculated Molecular Weight: 101 kDa Observed Molecular Weight: 99-101 kDa GenBank Accession Number: BC071579 Gene Symbol: MAP4K3 Gene ID (NCBI): 8491 RRID: AB_3086398 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924