Iright
BRAND / VENDOR: Proteintech

Proteintech, 30718-1-AP, MGAT4B Polyclonal antibody

CATALOG NUMBER: 30718-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MGAT4B (30718-1-AP) by Proteintech is a Polyclonal antibody targeting MGAT4B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30718-1-AP targets MGAT4B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: 37°C incubated mouse liver tissue, human liver tissue Positive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MGAT4B belongs to the N-Acetylglucosaminyltransferase-IV family and catalyzes the transfer of GlcNAc from UDP-GlcNAc to the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans through a beta1-4 linkage and participates in the production of tri- and tetra-antennary N-linked sugar chains (PMID: 17006639, 10372966). MGAT4B has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor to N-glycan biosynthesis (PMID:17006639). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33769 Product name: Recombinant human MGAT4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-446 aa of BC009464 Sequence: KTYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILSEIFLKKAD Predict reactive species Full Name: mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme B Calculated Molecular Weight: 548 aa, 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC009464 Gene Symbol: MGAT4B Gene ID (NCBI): 11282 RRID: AB_3086399 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQ53 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924