Proteintech, 30723-1-AP, Adiponectin Polyclonal antibody

Size: 20ul / 150ul The Adiponectin (30723-1-AP) by Proteintech is a Polyclonal antibody targeting Adiponectin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30723-1-AP targets Adiponectin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse adipose tissue, mouse serum Positive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Adiponectin (AdipoQ), an adipocyte-derived hormone, is one of the most abundant adipokines in the blood circulation. Adiponectin modulates a number of metabolic processes, including improving INS sensitivity and anti-inflammatory activity. The role of AdipoQ in reproduction is not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0262 Product name: Recombinant Mouse Adiponectin protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 18-247 aa of NM_009605 Sequence: EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN Predict reactive species Full Name: adiponectin, C1Q and collagen domain containing Calculated Molecular Weight: 27kd Observed Molecular Weight: 28 kDa GenBank Accession Number: NM_009605 Gene Symbol: Adiponectin Gene ID (NCBI): 11450 RRID: AB_3669755 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q60994 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.