Proteintech, 30732-1-AP, RNASE4 Polyclonal antibody

Size: 20ul / 150ul The RNASE4 (30732-1-AP) by Proteintech is a Polyclonal antibody targeting RNASE4 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 30732-1-AP targets RNASE4 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: human milk, THP-1 cells Positive IHC detected in: rat lung tissue, mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Human Ribonuclease 4 (RNase 4), one of the eight members of the human RNase A superfamily of endoribonucleases, is a uridine-specific endoribonuclease with a preference to cleave RNA after uridine residues prior to purines (PMID: 33818125). RNase 4 is a newly identified host defense peptide in the human kidney and bladder and kills uropathogenic E. coli (UPEC) and multi-drug resistant UPEC (PMID: 28955965). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29272 Product name: Recombinant human RNASE4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-147 aa of BC015520 Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG Predict reactive species Full Name: ribonuclease, RNase A family, 4 Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC015520 Gene Symbol: RNASE4 Gene ID (NCBI): 6038 RRID: AB_3086405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P34096 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.