Proteintech, 30733-1-AP, FAT1 Polyclonal antibody

Size: 20ul / 150ul The FAT1 (30733-1-AP) by Proteintech is a Polyclonal antibody targeting FAT1 in WB, IHC, ELISA applications with reactivity to human samples 30733-1-AP targets FAT1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAT1, also known as hFat1, belongs to a member of the cadherin superfamily, has been proposed to play roles in cerebral development, glomerular slit formation, and also to act as a tumor suppressor, but its mechanisms of action have not been elucidated. It is expected to be located in cell membrane and nucleus, which is expressed in many epithelial and some endothelial and smooth muscle cells. The calculated molecular weight of FAT1 is 506 kDa and there is glycosylation modification of the protein. To examine functions of the transmembrane and cytoplasmic domains, they were expressed in HEK-293 and HeLa cells as chimeric proteins in fusion with EGFP and extracellular domains derived from E-cadherin. Proteins comprising the transmembrane domain localized to the membrane fraction (PMID: 15922730, 26373379).The high molecular mass band observed at the expected 500-kDa size of FAT1 is indicated by an arrow together with a prominent band at 85 kDa (PMID: 21680732). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33957 Product name: Recombinant human FAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4390-4550 aa of Sequence: PSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMSEPQTKGTGENSTCREPHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVS Predict reactive species Full Name: FAT tumor suppressor homolog 1 (Drosophila) Observed Molecular Weight: 506-600 kDa Gene Symbol: FAT1 Gene ID (NCBI): 2195 RRID: AB_3086406 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14517 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.