Iright
BRAND / VENDOR: Proteintech

Proteintech, 30735-1-AP, SHLD3 Polyclonal antibody

CATALOG NUMBER: 30735-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SHLD3 (30735-1-AP) by Proteintech is a Polyclonal antibody targeting SHLD3 in WB, ELISA applications with reactivity to human, mouse samples 30735-1-AP targets SHLD3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SHLD3 (shieldin complex subunit 3), also known as RINN1 or CTC-534A2.2. It is located in Chromosome and expressed in monocyte. The gene is a component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs). It has been found that the proper function of MAD2L2 in shieldin requires its dimerization, and the interaction between MAD2L2 and SHLD3 is mediated and accelerated by SHLD2. The dimerization defect MAD2L2 damages the assembly of shieldin and cannot promote the NHEJ. In addition, the dimerization of MAD2L2 and the existence of SHLD3 allow shieldin to interact with TRIP13 ATPase (PMID: 34521823). The calculated molecular weight of SHLD3 is 28 kDa, the antibody can recognize the 70kDa band, which may be related to the interaction between MAD2L2 and SHLD3 as a dimer in shieldin complex. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32940 Product name: Recombinant human SHLD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of Sequence: MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM Predict reactive species Full Name: SHLD3 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 28-70 kDa Gene Symbol: SHLD3 Gene ID (NCBI): 112441434 RRID: AB_3086407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZNX1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924