Proteintech, 30761-1-AP, FAF2 Polyclonal antibody

Size: 20ul / 150ul The FAF2 (30761-1-AP) by Proteintech is a Polyclonal antibody targeting FAF2 in WB, ELISA applications with reactivity to Human samples 30761-1-AP targets FAF2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Protein ETEA (FAF2, or UBXD8) is a homolog to Fas-associated factor 1 (FAF1), which is involved in Fas-mediated apoptosis. ETEA protein directly interacts with and negatively regulates neurofibromin. ETEA contains both UBA and UBX domains and overexpression of ETEA downregulates neurofibromin in human cells. It may play a role in the translocation of terminally misfolded proteins from the endoplasmic reticulum lumen to the cytoplasm and their degradation by the proteasome. ETEA is highly expressed in peripheral blood of patients with atopic dermatitis (AD) compared to normal individuals, and may regulate the resistance to apoptosis that is observed in T cells and eosinophils of AD patients. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33251 Product name: Recombinant human FAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-445 aa of BC014001 Sequence: LKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEVLFVQDLTDE Predict reactive species Full Name: Fas associated factor family member 2 Calculated Molecular Weight: 445 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC014001 Gene Symbol: FAF2 Gene ID (NCBI): 23197 RRID: AB_3086412 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.