Proteintech, 30763-1-AP, PTPRM/RPTPmu Polyclonal antibody

Size: 20ul / 150ul The PTPRM/RPTPmu (30763-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRM/RPTPmu in WB, ELISA applications with reactivity to human, rat samples 30763-1-AP targets PTPRM/RPTPmu in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, U-87 MG cells, rat eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information PTPRM, also known as protein tyrosine phosphatase receptor type M or RPTPmu, is a protein with a molecular weight of approximately 155 kDa. It is a receptor-type tyrosine phosphatase involved in cell-cell adhesion, migration, and signaling. It exists in two forms, either a full-length 200 kDa form or as two noncovalently associated fragments of 100 kDa each.Additional unidentified serine proteases cleave PTPμ in GBM cells to yield smaller extracellular fragments with MWs of 78 and 55 kDa (PMID: 25223585). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33475 Product name: Recombinant human PTPRM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 765-880 aa of NM_002845 Sequence: KKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAI Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, M Calculated Molecular Weight: 164KD Observed Molecular Weight: 80 kDa, 100 kDa, 200 kDa GenBank Accession Number: NM_002845 Gene Symbol: PTPRM Gene ID (NCBI): 5797 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28827 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.