Proteintech, 30836-1-AP, NPNT Polyclonal antibody

Size: 20ul / 150ul The NPNT (30836-1-AP) by Proteintech is a Polyclonal antibody targeting NPNT in WB, ELISA applications with reactivity to human, mouse, rat samples 30836-1-AP targets NPNT in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34341 Product name: Recombinant human NPNT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 369-527 aa of BC166654 Sequence: TVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITL Predict reactive species Full Name: nephronectin Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62-70kDa GenBank Accession Number: BC166654 Gene Symbol: NPNT Gene ID (NCBI): 255743 RRID: AB_3669763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.