Iright
BRAND / VENDOR: Proteintech

Proteintech, 30844-1-AP, C19orf63 Polyclonal antibody

CATALOG NUMBER: 30844-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C19orf63 (30844-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf63 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30844-1-AP targets C19orf63 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, MG-63 cells Positive IHC detected in: human liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information EMC10 (Endoplasmic Reticulum Membrane Protein Complex Subunit 10) is one of the key components of the highly conserved endoplasmic reticulum membrane protein complex (EMC). The core function of this complex is to act as an insertase and chaperone in the endoplasmic reticulum, assisting in the correct folding, assembly, and membrane integration of membrane proteins, and preventing the aggregation of misfolded proteins. Studies have shown that EMC10 plays a dual role in cells: within the cell, it ensures the biogenesis of important membrane proteins such as G protein-coupled receptors (GPCRs); moreover, it can be secreted outside the cell (referred to as sEMC10), where it acts as a novel signaling molecule to activate the hypothalamic-pituitary axis, regulating energy metabolism and body weight in the body, and is closely related to obesity and metabolic diseases. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34064 Product name: Recombinant human C19orf63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC035001 Sequence: MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYW Predict reactive species Full Name: chromosome 19 open reading frame 63 Observed Molecular Weight: 28 kDa GenBank Accession Number: BC035001 Gene Symbol: C19orf63 Gene ID (NCBI): 284361 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5UCC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924