Proteintech, 30851-1-AP, SSR3 Polyclonal antibody

Size: 20ul / 150ul The SSR3 (30851-1-AP) by Proteintech is a Polyclonal antibody targeting SSR3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 30851-1-AP targets SSR3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, U-87 MG cells, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Mammalian TRAP is a heterotetrameric membrane protein complex which comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. SSR3 is also known as translocon-associated protein subunit gamma (TRAPG). The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. SSR3 assumes a central position in the mammalian TRAP complex, binding to the ribosome on the cytosolic face of the ER membrane and coordinating the remaining TRAP subunits with the ribosome and the other translocon components. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28130 Product name: Recombinant human SSR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-140 aa of BC017203 Sequence: TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFY Predict reactive species Full Name: signal sequence receptor, gamma (translocon-associated protein gamma) Calculated Molecular Weight: 185 aa, 21 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC017203 Gene Symbol: SSR3 Gene ID (NCBI): 6747 RRID: AB_3086422 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UNL2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.