Iright
BRAND / VENDOR: Proteintech

Proteintech, 30868-1-AP, MPC1 Polyclonal antibody

CATALOG NUMBER: 30868-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MPC1 (30868-1-AP) by Proteintech is a Polyclonal antibody targeting MPC1 in WB, ELISA applications with reactivity to human samples 30868-1-AP targets MPC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information MPC1, also known as BRP44L. BRP44L is predicted to be located in Mitochondrion inner membrane. The protein forms a heterodimer with MPC2, and the heterodimer is a more stable and dominant form (PMID:26253029, PMID:32403431). Mpc1 and Mpc2 associate to form an ~150-kilodalton complex in the inner mitochondrial membrane. Yeast and Drosophila mutants lacking MPC1 display impaired pyruvate metabolism, with an accumulation of upstream metabolites and a depletion of tricarboxylic acid cycle intermediates. Loss of yeast Mpc1 results in defective mitochondrial pyruvate uptake, and silencing of MPC1 or MPC2 in mammalian cells impairs pyruvate oxidation. A point mutation in MPC1 provides resistance to a known inhibitor of the mitochondrial pyruvate carrier (PMID: 22628558).The molecular weight of MPC1 is 12 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28826 Product name: Recombinant human BRP44L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC000810 Sequence: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA Predict reactive species Full Name: brain protein 44-like Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa, 20-24 kDa GenBank Accession Number: BC000810 Gene Symbol: BRP44L Gene ID (NCBI): 51660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5U8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924