Proteintech, 30875-1-AP, CEACAM8/CD66b Polyclonal antibody

Size: 20ul / 150ul The CEACAM8/CD66b (30875-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM8/CD66b in WB, ELISA applications with reactivity to human samples 30875-1-AP targets CEACAM8/CD66b in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), also known as CD66b, CGM6 or NCA-95, is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAM8 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes (PMID: 8104998; 18056392). It is involved in regulating adhesion and activation of eosinophils (PMID: 18056392). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg32133 Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 35-319 aa of BC026263 Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 8 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 95-100kDa GenBank Accession Number: BC026263 Gene Symbol: CEACAM8 Gene ID (NCBI): 1088 RRID: AB_3669772 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31997 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.