Iright
BRAND / VENDOR: Proteintech

Proteintech, 30909-1-AP, COQ2 Polyclonal antibody

CATALOG NUMBER: 30909-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The COQ2 (30909-1-AP) by Proteintech is a Polyclonal antibody targeting COQ2 in WB, ELISA applications with reactivity to Human samples 30909-1-AP targets COQ2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information COQ2 (coenzyme Q2, polyprenyltransferase), also known as CL640. It is expected to be located in mitochondrion inner membrane. And the protein is highly expressed in skeletal muscle, adrenal glands and the heart. COQ2 is a redox carrier in the mitochondrial respiratory chain and a lipid-soluble antioxidant. This enzyme, which is part of the coenzyme Q10 pathway, catalyzes the prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations in this gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. The protein has three isforms, the calculated molecular weight are 35, 40, 45 kDa. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29155 Product name: Recombinant human COQ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-146 aa of BC008804 Sequence: AGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDQDYDKKVTRTAN Predict reactive species Full Name: coenzyme Q2 homolog, prenyltransferase (yeast) Calculated Molecular Weight: 371 aa, 40 kDa Observed Molecular Weight: 35 kDa,40 kDa,45 kDa GenBank Accession Number: BC008804 Gene Symbol: COQ2 Gene ID (NCBI): 27235 RRID: AB_3669780 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96H96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924