Iright
BRAND / VENDOR: Proteintech

Proteintech, 30910-1-AP, SMAGP Polyclonal antibody

CATALOG NUMBER: 30910-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SMAGP (30910-1-AP) by Proteintech is a Polyclonal antibody targeting SMAGP in WB, IF/ICC, ELISA applications with reactivity to human samples 30910-1-AP targets SMAGP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, mouse colon tissue, mouse lung tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Small transmembrane and glycosylated protein (SMAGP) consists of 97 amino acids and contains a transmembrane domain. SMAGP localizes to the lateral face of the plasma membrane and is expressed in the cytoplasm after cell transformation. (PMID: 30410350) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34278 Product name: Recombinant human LOC57228 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-97 aa of BC120965 Sequence: VVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI Predict reactive species Full Name: small trans-membrane and glycosylated protein Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC120965 Gene Symbol: SMAGP Gene ID (NCBI): 57228 RRID: AB_3669781 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q0VAQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924