Proteintech, 30911-1-AP, KCNJ18 Polyclonal antibody

Size: 20ul / 150ul The KCNJ18 (30911-1-AP) by Proteintech is a Polyclonal antibody targeting KCNJ18 in WB, IF-P, ELISA applications with reactivity to Human, mouse samples 30911-1-AP targets KCNJ18 in WB, IF-P, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse skin tissue Positive IF-P detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Mutations in KCNJ18 gene encoding an inwardly rectifying potassium channel (Kir2.6) cause thyrotoxic periodic paralysis (TPP) and sporadic, that is, non-familial cases of HypoPP. Mutant Kir2.6 proteins form a heterotetrameric Kir channel complex with Kir2.1 and thereby reduce cell surface expression of the complex. (PMID: 25882930) Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34177 Product name: Recombinant human KCNJ18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 353-433 aa of NM_001194958 Sequence: STPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRGSEI Predict reactive species Full Name: similar to hkir2.2x Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_001194958 Gene Symbol: KCNJ18 Gene ID (NCBI): 100134444 RRID: AB_3669782 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: B7U540 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.