Iright
BRAND / VENDOR: Proteintech

Proteintech, 30923-1-AP, AHCTF1 Polyclonal antibody

CATALOG NUMBER: 30923-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AHCTF1 (30923-1-AP) by Proteintech is a Polyclonal antibody targeting AHCTF1 in WB, IF/ICC, ELISA applications with reactivity to human samples 30923-1-AP targets AHCTF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information AHCTF1, also known as ELYS, TMBS62, is a large multifunctional protein. It plays essential roles in nuclear pore assembly and mitosis. AHCTF1 was expressed at higher levels in embryonic liver, spleen and thymus compared to the corresponding adult tissues (PMID: 11952839) and has 3 isoforms with MW of 252~256 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32788 Product name: Recombinant human AHCTF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2067-2266 aa of NM_001323342.1 Sequence: ERTDEMTHKETNEQEERLLATASFTKSSRSSRTRSSKAILLPDLSEPNNEPLFSPASEVPRKAKAKKIEVPAQLKELVSDLSSQFVISPPALRSRQKNTSNKNKLEDELKDDAQSVETLGKPKAKRIRTSKTKQASKNTEKESAWSPPPIEIRLISPLASPADGVKSKPRKTTEVTGTGLGRNRKKLSSYPKQILRRKML Predict reactive species Full Name: AT hook containing transcription factor 1 Calculated Molecular Weight: 252 kDa Observed Molecular Weight: 270 kDa GenBank Accession Number: NM_001323342.1 Gene Symbol: AHCTF1 Gene ID (NCBI): 25909 RRID: AB_3669786 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WYP5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924