Proteintech, 30980-1-AP, VEGFB Polyclonal antibody

Size: 20ul / 150ul The VEGFB (30980-1-AP) by Proteintech is a Polyclonal antibody targeting VEGFB in WB, ELISA applications with reactivity to human samples 30980-1-AP targets VEGFB in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34269 Product name: Recombinant human VEGFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 129-207 aa of BC008818 Sequence: KDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA Predict reactive species Full Name: vascular endothelial growth factor B Calculated Molecular Weight: 22 kDa GenBank Accession Number: BC008818 Gene Symbol: VEGFB Gene ID (NCBI): 7423 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P49765 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.