Iright
BRAND / VENDOR: Proteintech

Proteintech, 30987-1-AP, PTF1A Polyclonal antibody

CATALOG NUMBER: 30987-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PTF1A (30987-1-AP) by Proteintech is a Polyclonal antibody targeting PTF1A in WB, ELISA applications with reactivity to mouse, rat, human samples 30987-1-AP targets PTF1A in WB, ELISA applications and shows reactivity with mouse, rat, human samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: mouse, rat, human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34321 Product name: Recombinant human PTF1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 155-328 aa of NM_178161 Sequence: VRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS Predict reactive species Full Name: pancreas specific transcription factor, 1a Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_178161 Gene Symbol: PTF1A Gene ID (NCBI): 256297 RRID: AB_3669807 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7RTS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924