Iright
BRAND / VENDOR: Proteintech

Proteintech, 30990-1-AP, RBM12 Polyclonal antibody

CATALOG NUMBER: 30990-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RBM12 (30990-1-AP) by Proteintech is a Polyclonal antibody targeting RBM12 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 30990-1-AP targets RBM12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MOLT-4 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RNA binding motif protein 12 (RBM12) is a member of the RBM family. RBM proteins are involved in RNA metabolism, including splicing, transport, translation and stability. RBM12 has been identified as a key protein that increases the expression of PD-L1, thereby promoting immune evasion in hepatocellular carcinoma (PMID: 39187545). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34621 Product name: Recombinant human RBM12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-932 aa of BC013981 Sequence: GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG Predict reactive species Full Name: RNA binding motif protein 12 Observed Molecular Weight: 100 kDa GenBank Accession Number: BC013981 Gene Symbol: RBM12 Gene ID (NCBI): 10137 RRID: AB_3669810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NTZ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924