Product Description
Size: 20ul / 150ul
The RBM12 (30990-1-AP) by Proteintech is a Polyclonal antibody targeting RBM12 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
30990-1-AP targets RBM12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MOLT-4 cells
Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: U2OS cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
RNA binding motif protein 12 (RBM12) is a member of the RBM family. RBM proteins are involved in RNA metabolism, including splicing, transport, translation and stability. RBM12 has been identified as a key protein that increases the expression of PD-L1, thereby promoting immune evasion in hepatocellular carcinoma (PMID: 39187545).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag34621 Product name: Recombinant human RBM12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-932 aa of BC013981 Sequence: GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG Predict reactive species
Full Name: RNA binding motif protein 12
Observed Molecular Weight: 100 kDa
GenBank Accession Number: BC013981
Gene Symbol: RBM12
Gene ID (NCBI): 10137
RRID: AB_3669810
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q9NTZ6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924