Proteintech, 30991-1-AP, PCYT1A Polyclonal antibody

Size: 20ul / 150ul The PCYT1A (30991-1-AP) by Proteintech is a Polyclonal antibody targeting PCYT1A in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30991-1-AP targets PCYT1A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, mouse testis tissue, rat testis tissue, ARPE-19 cells, Y79 cells Positive IF/ICC detected in: U-251 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PCYT1A (phosphate cytidylyltransferase 1A, choline), also known as CTPCT. It is expected to be located in the nucleus and cytoplasm, which is enriched in brain, placenta, liver, fetal and adult lung. This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. The molecular weight of PCYT1A is 41 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species Full Name: phosphate cytidylyltransferase 1, choline, alpha Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 40-41 kDa GenBank Accession Number: NM_005017 Gene Symbol: PCYT1A Gene ID (NCBI): 5130 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P49585 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.