Product Description
Size: 20ul / 150ul
The GRSF1 (30992-1-AP) by Proteintech is a Polyclonal antibody targeting GRSF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
30992-1-AP targets GRSF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, PANC-1 cells
Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: U-251 cells, A431 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Grsf1 (G-rich RNA sequence binding factor 1) is an RNA-binding protein, which belongs to the F/H family of heterogeneous ribonucleoprotein, and contains three quasi-RNA recognition motifs (qRRM). These domains enable it to bind to RNA molecules, and it interacts with various RNA molecules, including mRNA, lncRNA and circRNA, affecting the metabolism and function of these RNAs. The expression of GRSF1 is closely related to cell senescence. It was found that with the aging of cells, the methylation level in the promoter region of GRSF1 gene increased, which led to the decrease of its expression. The decrease of GRSF1 expression is related to the activation of various aging-related markers and the increase of the secretion of aging-related secretory phenotype (SASP) factors, which may play a key role in maintaining the normal function of cells and delaying the aging process. GRSF1 also plays an important role in the mitochondria of cells. It interacts with RNase P and participates in the processing of mitochondrial RNA, including the processing of classical and tRNA-free RNA precursors. In the case of GRSF1 deletion, the primary transcript of mitochondrial RNA is cut abnormally, which leads to the decrease of the expression of mitochondrial coding protein, and then causes mitochondrial dysfunction. Isoform 1, 53 kDa, located in mitochondria; Isoform 2, 36 kDa, located in cytoplasm.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag34305 Product name: Recombinant human GRSF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-404 aa of NM_002092 Sequence: MDYRGRRKTGEAYVQFEEPEMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH Predict reactive species
Full Name: G-rich RNA sequence binding factor 1
Calculated Molecular Weight: 53 kDa
Observed Molecular Weight: 50-53 kDa
GenBank Accession Number: NM_002092
Gene Symbol: GRSF1
Gene ID (NCBI): 2926
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q12849
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924