Iright
BRAND / VENDOR: Proteintech

Proteintech, 31001-1-AP, LRMDA Polyclonal antibody

CATALOG NUMBER: 31001-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LRMDA (31001-1-AP) by Proteintech is a Polyclonal antibody targeting LRMDA in WB, IHC, ELISA applications with reactivity to human, mouse samples 31001-1-AP targets LRMDA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, THP-1 cells Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The LRMDA gene, also known as C10orf11, encodes a leucine-rich repeating protein that is thought to play a role in melanocyte differentiation. Variants in this gene have been associated with autosomal recessive oculocutaneous albinism 7 (OCA7), but have never been implicated in metabolic disorders. Interestingly, however, the variant associated with age at diabetes onset is also associated with differences in LRMDA expression in the brain, including the hypothalamus, where peptides controlling pigmentation, such as melanocortins and their receptors, are involved in the regulation of body weight and metabolism. (PMID: 36104811) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33898 Product name: Recombinant human LRMDA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of NM_032024 Sequence: MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL Predict reactive species Full Name: chromosome 10 open reading frame 11 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: NM_032024 Gene Symbol: LRMDA/C10orf11 Gene ID (NCBI): 83938 RRID: AB_3669812 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H2I8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924