Proteintech, 31006-1-AP, FAM46A Polyclonal antibody

Size: 20ul / 150ul The FAM46A (31006-1-AP) by Proteintech is a Polyclonal antibody targeting FAM46A in WB, ELISA applications with reactivity to human samples 31006-1-AP targets FAM46A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FAM46A, also known as TENT5A, is a member of the FAM46 subfamily of the nucleotidyltransferase fold superfamily. It has two isoforms and has been implicated in several human diseases including retinitis pigmentosa, bone abnormalities, cancer and obesity (PMID: 32528962). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33896 Product name: Recombinant human FAM46A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC000683 Sequence: MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI Predict reactive species Full Name: family with sequence similarity 46, member A Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC000683 Gene Symbol: FAM46A Gene ID (NCBI): 55603 RRID: AB_3669813 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.