Proteintech, 31014-1-AP, CD3EAP Polyclonal antibody

Size: 20ul / 150ul The CD3EAP (31014-1-AP) by Proteintech is a Polyclonal antibody targeting CD3EAP in WB, IF/ICC, ELISA applications with reactivity to human samples 31014-1-AP targets CD3EAP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HeLa cells, NCI-H1299 cells Positive IF/ICC detected in: HeLa cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human RNA polymerase I (Pol I)-specific subunit, previously identified as ASE-1 and as CD3ɛ-associated signal transducer (CAST), CD3EAP is a 55 kDa nucleolar autoantigen that has an apparent molecular mass of 90 kDa (PMID: 11199923). CD3EAP/hPAF49 contains a single tyrosine residue at position 82 (Tyr82), which is phosphorylated upon stimulation of the T-cell receptor. Western blot analysis detected CD3EAP at an apparent molecular mass of ~80-90 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34108 Product name: Recombinant human CD3EAP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-240 aa of NM_012099.1 Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPRSALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLE Predict reactive species Full Name: CD3e molecule, epsilon associated protein Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: NM_012099.1 Gene Symbol: CD3EAP Gene ID (NCBI): 10849 RRID: AB_3669815 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O15446 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.