Proteintech, 31020-1-AP, Caspase 1 Polyclonal antibody

Size: 20ul / 150ul The Caspase 1 (31020-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 1 in WB, ELISA applications with reactivity to mouse, rat samples 31020-1-AP targets Caspase 1 in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). 31020-1-AP is designed for mouse caspase 1. Specification Tested Reactivity: mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34441 Product name: Recombinant mouse Casp1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-296 aa of BC008152 Sequence: DNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFK Predict reactive species Full Name: caspase 1 Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC008152 Gene Symbol: Caspase 1 Gene ID (NCBI): 12362 RRID: AB_3669817 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P29452 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.