Proteintech, 31030-1-AP, SVEP1 Polyclonal antibody

Size: 20ul / 150ul The SVEP1 (31030-1-AP) by Proteintech is a Polyclonal antibody targeting SVEP1 in WB, ELISA applications with reactivity to human samples 31030-1-AP targets SVEP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells, SMMC-7721 cells, human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SVEP1 (C9orf13), which is predicted to be located in the cell membrane, nucleus and cytoplasm. The protein is expressed in the whole epidermis, especially in the basal layer of epidermis, the upper and lower layers of basal layer and dermal fibroblasts in the upper dermis (PMID:27892606). At the same time, it is highly expressed in placenta, lung, adrenal gland and cerebellum, but weakly expressed in heart and skeletal muscle (PMID:11062057, PMID:27892606). The molecular weight of SVEP1 is 390 kDa. At the same time, it also has several isomers of 96kDa, 163kDa and 170kDa, and there are also glycosylation modifications. It is reported that the molecular weight is 460 kDa (PMID: 32371982). The protein may plays a role in initial cell attachment of stromal osteogenic cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34316 Product name: Recombinant human SVEP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 736-900 aa of NM_153366 Sequence: GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSFCSDAEDIDCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNAKS Predict reactive species Full Name: sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 Calculated Molecular Weight: 390 kDa Observed Molecular Weight: 460 kDa GenBank Accession Number: NM_153366 Gene Symbol: SVEP1 Gene ID (NCBI): 79987 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q4LDE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.