Proteintech, 31031-1-AP, SLC46A3 Polyclonal antibody

Size: 20ul / 150ul The SLC46A3 (31031-1-AP) by Proteintech is a Polyclonal antibody targeting SLC46A3 in IHC, ELISA applications with reactivity to Human, mouse samples 31031-1-AP targets SLC46A3 in IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Solute carrier family 46 member 3 (SLC46A3) is a lysosomal membrane protein that belongs to the SLC46A family. SLC46A3 has been reported to be a proton-coupled, steroid conjugate, and bile acid transporter (PMID: 36741448). SLC46A3 plays an important role in Trastuzumab emtansine (T-DM1) treatment, a successful noncleavable antibody-drug conjugates (ADC) (PMID: 36741448). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34359 Product name: Recombinant human SLC46A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-73 aa of BC060850 Sequence: QYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFN Predict reactive species Full Name: solute carrier family 46, member 3 Calculated Molecular Weight: 463 aa, 52 kDa GenBank Accession Number: BC060850 Gene Symbol: SLC46A3 Gene ID (NCBI): 283537 RRID: AB_3669822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z3Q1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.