Proteintech, 31038-1-AP, INTS8 Polyclonal antibody

Size: 20ul / 150ul The INTS8 (31038-1-AP) by Proteintech is a Polyclonal antibody targeting INTS8 in WB, ELISA applications with reactivity to Human samples 31038-1-AP targets INTS8 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information Integrator complex subunit 8 (INTS8) is one of the major components of RNA polymerase II and has been demonstrated to be involved in the cleavage of small nuclear RNAs and transcriptional processes (PMID: 34880328). INTS8 was robustly increased in neurodevelopmental diseases and numerous tumors. High INTS8 expression has a tight correlation with poor prognosis in multi-cancers (PMID: 30881114). Western blot analysis detected INTS8 at an apparent molecular mass of 111 kDa. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34627 Product name: Recombinant human INTS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 896-995 aa of BC136754 Sequence: QVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF Predict reactive species Full Name: integrator complex subunit 8 Calculated Molecular Weight: 111 kDa Observed Molecular Weight: 111 kDa GenBank Accession Number: BC136754 Gene Symbol: INTS8 Gene ID (NCBI): 55656 RRID: AB_3669824 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q75QN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.