Proteintech, 31043-1-AP, NRG1, isoform Alpha Polyclonal antibody

Size: 20ul / 150ul The NRG1, isoform Alpha (31043-1-AP) by Proteintech is a Polyclonal antibody targeting NRG1, isoform Alpha in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31043-1-AP targets NRG1, isoform Alpha in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Neuregulin 1 (NRG1) is a trophic factor that has been implicated in neural development, neurotransmission, and synaptic plasticity. NRG1 has multiple isoforms that are generated by usage of different promoters and alternative splicing of a single gene. NRG1 and its receptor ErbB tyrosine kinase are expressed not only in the developing nervous system, but also in the adult brain. The immunogen of this antibody is against NRG1 isoform Alpha. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species Full Name: neuregulin 1 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC007675 Gene Symbol: NRG1 Gene ID (NCBI): 3084 RRID: AB_3669828 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.