Iright
BRAND / VENDOR: Proteintech

Proteintech, 31047-1-AP, PRODH2 Polyclonal antibody

CATALOG NUMBER: 31047-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PRODH2 (31047-1-AP) by Proteintech is a Polyclonal antibody targeting PRODH2 in WB, ELISA applications with reactivity to Human, mouse samples 31047-1-AP targets PRODH2 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, human testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PRODH2 is a dehydrogenase that converts trans-4-L-hydroxyproline to delta-1-pyrroline-3-hydroxy-5-carboxylate (Hyp) using ubiquinone-10 as the terminal electron acceptor. It can also use proline as a substrate but with a very much lower efficiency (PMID: 25697095). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33970 Product name: Recombinant human PRODH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-316 aa of BC166629 Sequence: PTEEEPDSAAKSGEAWYEGNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQNQHLRASLSRLHRVAQYARAQHVRLLVDAE Predict reactive species Full Name: proline dehydrogenase (oxidase) 2 Observed Molecular Weight: 50 kDa GenBank Accession Number: BC166629 Gene Symbol: PRODH2 Gene ID (NCBI): 58510 RRID: AB_3669831 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UF12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924