Proteintech, 31068-1-AP, NTT4 Polyclonal antibody

Size: 20ul / 150ul The NTT4 (31068-1-AP) by Proteintech is a Polyclonal antibody targeting NTT4 in WB, ELISA applications with reactivity to Human, mouse, rat samples 31068-1-AP targets NTT4 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue, unboiled mouse cerebellum tissue, unboiled rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC6A17 also known as NTT4, is a member of the SLC6 family of transporters, which are responsible for the presynaptic uptake of most neurotransmitters. SLC6A17 is a transporter for neutral amino acids and is exclusively expressed in the brain(PMID: 23672601). Defects in SLC6A17 cause Intellectual developmental disorder, autosomal recessive 48(PMID: 25704603). For optimal WB detection with 31068-1-AP, we do not recommend boiling the sample after lysis. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34522 Product name: Recombinant human SLC6A17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-440 aa of NM_001010898 Sequence: GFKANIMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGL Predict reactive species Full Name: solute carrier family 6, member 17 Calculated Molecular Weight: 727 aa, 81 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001010898 Gene Symbol: NTT4 Gene ID (NCBI): 388662 RRID: AB_3669841 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H1V8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.