Proteintech, 31079-1-AP, DNAH5 Polyclonal antibody

Size: 20ul / 150ul The DNAH5 (31079-1-AP) by Proteintech is a Polyclonal antibody targeting DNAH5 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31079-1-AP targets DNAH5 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human lung tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Dynein axonemal heavy chain 5 (DNAH5) is an axonemal heavy chain dynein, part of a microtubule-associated motor protein complex. DNAH5 is a large gene comprising 79 exons and one alternative first exon and encodes a heavy chain of the ODA. We have recently shown that recessive DNAH5 mutations are responsible for PCD characterized by ODA defects. DNAH5 mutations cause PCD and randomization of left-right asymmetry (PMID: 15750039). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34647 Product name: Recombinant human DNAH5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-150 aa of NM_001369 Sequence: LNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSF Predict reactive species Full Name: dynein, axonemal, heavy chain 5 Calculated Molecular Weight: 529 kDa GenBank Accession Number: NM_001369 Gene Symbol: DNAH5 Gene ID (NCBI): 1767 RRID: AB_3669844 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TE73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.