Iright
BRAND / VENDOR: Proteintech

Proteintech, 31093-1-AP, PYROXD1 Polyclonal antibody

CATALOG NUMBER: 31093-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PYROXD1 (31093-1-AP) by Proteintech is a Polyclonal antibody targeting PYROXD1 in WB, ELISA applications with reactivity to human samples 31093-1-AP targets PYROXD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information pyridine nucleotide-disulfide oxidoreductase domain 1 (PYROXD1) is a putative oxidoreductase that co-evolved with the tRNA-LC and is essential for its activity in cells and in vivo. PYROXD1 oxidizes NAD(P)H to NAD(P)+ with tightly controlled kinetics, reducing one molecule of O2 into H2O2 per turnover. PYROXD1 is expressed across a range of tissue types in humans, including skeletal muscle, and is conserved across many species. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34768 Product name: Recombinant human PYROXD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-357 aa of BC021662 Sequence: MLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDKAIGNTFFDAGAAEFLTSKLIAEKSEAKIAHKRTRYTTEGRKKEARSKSKADNVGSALGPDWHEGLNLKGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSFTFPRDHKSVTADTEMWPVYVELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFDLGEDGGLKVDDHMHTSLPDIYAAG Predict reactive species Full Name: pyridine nucleotide-disulphide oxidoreductase domain 1 Observed Molecular Weight: 55 kDa GenBank Accession Number: BC021662 Gene Symbol: PYROXD1 Gene ID (NCBI): 79912 RRID: AB_3669851 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WU10 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924