Proteintech, 31109-1-AP, CBX5 Polyclonal antibody

Size: 20ul / 150ul The CBX5 (31109-1-AP) by Proteintech is a Polyclonal antibody targeting CBX5 in WB, ELISA applications with reactivity to human samples 31109-1-AP targets CBX5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443). This antibody is a rabbit polyclonal antibody raised against a full-length human HP1A protein ,and can reacts with the 28kd HP1A protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34810 Product name: Recombinant human CBX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-120 aa of BC006821 Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG Predict reactive species Full Name: chromobox homolog 5 (HP1 alpha homolog, Drosophila) Calculated Molecular Weight: 191 aa, 22 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC006821 Gene Symbol: CBX5 Gene ID (NCBI): 23468 RRID: AB_3669860 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P45973 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.