Proteintech, 31128-1-AP, IGFBP7 Polyclonal antibody

Size: 20ul / 150ul The IGFBP7 (31128-1-AP) by Proteintech is a Polyclonal antibody targeting IGFBP7 in WB, ELISA applications with reactivity to human, mouse samples 31128-1-AP targets IGFBP7 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0815 Product name: Recombinant Human IGFBP-7 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 27-282 aa of NM_001553.2 Sequence: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRRGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL Predict reactive species Full Name: insulin-like growth factor binding protein 7 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29-35 kDa GenBank Accession Number: NM_001553.2 Gene Symbol: IGFBP7 Gene ID (NCBI): 3490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16270-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.