Proteintech, 31148-1-AP, C18orf34 Polyclonal antibody

Size: 20ul / 150ul The C18orf34 (31148-1-AP) by Proteintech is a Polyclonal antibody targeting C18orf34 in WB, ELISA applications with reactivity to Human, mouse, rat samples 31148-1-AP targets C18orf34 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat ovary tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33847 Product name: Recombinant human C18orf34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC130535 Sequence: MTENKTVSSSSTRDDQTNIGLTCQEVKALREKAWSRTNEGNAMSQSLVLYGASKENSEGFHESKMTNTEGVNKGIYFSYPCRRHSCAVVNIPAPCVNKMISHIQDVESKIQEHLKRFETSFEEWSRTSSTKDLKEDWSVTTPVKEVKPGEKRDEKCPELKQEMETLLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQELQDLKNHYKKKMEVMDLHRKVNEELEEALEACENARLKAQQIKEEIDKDIYQDEKTIEAYKREIYQLNSL Predict reactive species Full Name: chromosome 18 open reading frame 34 Observed Molecular Weight: 95-102 kDa GenBank Accession Number: BC130535 Gene Symbol: C18orf34 Gene ID (NCBI): 374864 RRID: AB_3669871 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5BJE1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.