Iright
BRAND / VENDOR: Proteintech

Proteintech, 31150-1-AP, TBL3 Polyclonal antibody

CATALOG NUMBER: 31150-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TBL3 (31150-1-AP) by Proteintech is a Polyclonal antibody targeting TBL3 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse samples 31150-1-AP targets TBL3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, mouse testis tissue Positive IF/ICC detected in: A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Transducin (beta)-like 3 (TBL3) is a protein of 808 amino acids with an apparent molecular weight of 89 kilodaltons.In mice, Tbl3 is a newly recognized nucleolar protein with regulatory roles in ribosome biogenesis (doi: 10.5315/wjh.v3.i3.93). In zebrafish, Tbl3 plays a tissue-specific role in regulating cell cycle rate during development(PMID: 22659140). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34900 Product name: Recombinant human TBL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 591-720 aa of BC010231 Sequence: TIKNNECVRTLDAHEDKVWGLHCSRLDDHALTGASDSRVILWKDVTEAEQAEEQARQEEQVVRQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLEATMLRLRRDQKEALLRFCVT Predict reactive species Full Name: transducin (beta)-like 3 Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 89 kDa GenBank Accession Number: BC010231 Gene Symbol: TBL3 Gene ID (NCBI): 10607 RRID: AB_3669872 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q12788 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924