Iright
BRAND / VENDOR: Proteintech

Proteintech, 31161-1-AP, C18orf24 Polyclonal antibody

CATALOG NUMBER: 31161-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C18orf24 (31161-1-AP) by Proteintech is a Polyclonal antibody targeting C18orf24 in WB, ELISA applications with reactivity to Human, mouse, rat samples 31161-1-AP targets C18orf24 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, U2OS cells, mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information C18orf24(Spindle and kinetochore-associated protein 1, SKA1) is involved in chromosome congression and mitosis. It is upregulated and oncogenic in several human cancers (PMID: 31827398). In the human genome, SKA1, SKA2, and SKA3 constitute the SKA complex; this is necessary to maintain spindle microtubule attachment to kinetochores during mitosis (PMID: 36397719). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34772 Product name: Recombinant human C18orf24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC015706 Sequence: MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT Predict reactive species Full Name: chromosome 18 open reading frame 24 Observed Molecular Weight: 32 kDa GenBank Accession Number: BC015706 Gene Symbol: C18orf24 Gene ID (NCBI): 220134 RRID: AB_3669875 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96BD8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924