Proteintech, 31164-1-AP, GOLGA5 Polyclonal antibody

Size: 20ul / 150ul The GOLGA5 (31164-1-AP) by Proteintech is a Polyclonal antibody targeting GOLGA5 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 31164-1-AP targets GOLGA5 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GOLGA5 (Golgin subfamily A member 5) maintains Golgi structure, and stimulates the formation of Golgi stacks and ribbons. Also, it is involved in intra-Golgi retrograde transport (PMID: 12538640; 15718469). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35031 Product name: Recombinant human GOLGA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-410 aa of BC023021 Sequence: RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDEL Predict reactive species Full Name: golgi autoantigen, golgin subfamily a, 5 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 83-95 kDa GenBank Accession Number: BC023021 Gene Symbol: GOLGA5 Gene ID (NCBI): 9950 RRID: AB_3669878 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TBA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.