Proteintech, 31165-1-AP, OLFML1 Polyclonal antibody

Size: 20ul / 150ul The OLFML1 (31165-1-AP) by Proteintech is a Polyclonal antibody targeting OLFML1 in WB, ELISA applications with reactivity to human, mouse, rat samples 31165-1-AP targets OLFML1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HuH-7 cells, U-251 cells, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information OLFML1 (Olfactomedin-like protein 1) is a novel member of human OLF protein family with an olfectamine domain (143-397 aa) in its C-terminus. OLFML1 exhibits the promotion of cell proliferation, along with the increase of percentage of S phase cells. OLFML1 is considered a secreted glycoprotein that enhances cell cycle progression in human cancer cell lines in vitro (PMID: 30266405). OLFML1 contains three potential N-glycosylation sites (residues 66, 138 and 183) and could be modified by the N-glycosylation (PMID: 18708057). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35125 Product name: Recombinant human OLFML1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-160 aa of BC092488 Sequence: QRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIVSEDKTLAEMLLQEAEEEKKIRTLLNASCDNMLMGIKSLKIVKKMMDT Predict reactive species Full Name: olfactomedin-like 1 Calculated Molecular Weight: 402 aa, 46 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC092488 Gene Symbol: OLFML1 Gene ID (NCBI): 283298 RRID: AB_3669879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6UWY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.