Proteintech, 31166-1-AP, MMGT1 Polyclonal antibody

Size: 20ul / 150ul The MMGT1 (31166-1-AP) by Proteintech is a Polyclonal antibody targeting MMGT1 in WB, ELISA applications with reactivity to human samples 31166-1-AP targets MMGT1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-468 cells, PC-3 cells, SW480 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information MMGT1 (Membrane Magnesium Transporter 1) is a protein encoded by the MMGT1 gene in humans. It is also known by the aliases EMC5 and TMEM32. This protein is a member of the magnesium transporter family and is involved in the transport of magnesium ions across cell membranes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35121 Product name: Recombinant human MMGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-131 aa of BC033588 Sequence: GEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR Predict reactive species Full Name: membrane magnesium transporter 1 Calculated Molecular Weight: 131 aa, 15 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC033588 Gene Symbol: MMGT1 Gene ID (NCBI): 93380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N4V1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.