Iright
BRAND / VENDOR: Proteintech

Proteintech, 31169-1-AP, TRMT61A Polyclonal antibody

CATALOG NUMBER: 31169-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRMT61A (31169-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT61A in WB, ELISA applications with reactivity to human, mouse samples 31169-1-AP targets TRMT61A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 5637 cells, RAW 264.7 cells, MCF-7 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information N1-methyladenosine (m1A) is an important posttranscriptional modification and occurs throughout the tRNA structure.m1A at position 58 (m1A58) is the predominant m1A modification of cytoplasmic tRNA in eukaryotic cells. The formation of m1A58 on cytoplasmic tRNAs is mediated by the methyltransferase complex TRMT6/TRMT61A, in which TRMT61A functions as the catalytic subunit and TRMT6 is responsible for tRNA binding. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34396 Product name: Recombinant human TRMT61A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-289 aa of BC010167 Sequence: SFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG Predict reactive species Full Name: tRNA methyltransferase 61 homolog A (S. cerevisiae) Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC010167 Gene Symbol: TRMT61A Gene ID (NCBI): 115708 RRID: AB_3669880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96FX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924