Iright
BRAND / VENDOR: Proteintech

Proteintech, 31181-1-AP, LAMA2 Polyclonal antibody

CATALOG NUMBER: 31181-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LAMA2 (31181-1-AP) by Proteintech is a Polyclonal antibody targeting LAMA2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 31181-1-AP targets LAMA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse skeletal muscle tissue, rat heart tissue Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The laminin subunit alpha 2 (LAMA2) gene encodes an alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Basal laminae are structural components of the extracellular matrix that influence cell proliferation and differentiation,7 and laminin subunit alpha 2 (LAMA2) is the major component of the basal laminae-α subunit of laminin. (PMID: 30728939) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34494 Product name: Recombinant human LAMA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2100-2250 aa of NM_000426 Sequence: IDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGTISVRALDG Predict reactive species Full Name: laminin, alpha 2 Calculated Molecular Weight: 344 kDa Observed Molecular Weight: 344 kDa GenBank Accession Number: NM_000426 Gene Symbol: LAMA2 Gene ID (NCBI): 3908 RRID: AB_3669885 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P24043 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924