Proteintech, 31182-1-AP, SLC2A7 Polyclonal antibody

Size: 20ul / 150ul The SLC2A7 (31182-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A7 in IHC, ELISA applications with reactivity to human, mouse samples 31182-1-AP targets SLC2A7 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC2A7 (solute carrier family 2 member 7, also known as GLUT7) belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34515 Product name: Recombinant human SLC2A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-281 aa of NM_207420 Sequence: PESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLR Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 7 Calculated Molecular Weight: 512 aa, 56 kDa GenBank Accession Number: NM_207420 Gene Symbol: SLC2A7 Gene ID (NCBI): 155184 RRID: AB_3669886 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6PXP3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.