Iright
BRAND / VENDOR: Proteintech

Proteintech, 31187-1-AP, PCARE Polyclonal antibody

CATALOG NUMBER: 31187-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PCARE (31187-1-AP) by Proteintech is a Polyclonal antibody targeting PCARE in WB, ELISA applications with reactivity to Human, mouse, rat samples 31187-1-AP targets PCARE in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, mouse retina tissue, rat eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information C2orf71/PCARE (photoreceptor cilium actin regulator) is a retina-specific protein consisting of 1289 amino acids with a predicted molecular weight of 140 kDa. PCARE is predicted to be myristoylated and palmitoylated at its N terminus and plays an important role in delivering actin-associated components to the base of the photoreceptor OSs to regulate the initial development of OS disks (PMID: 32312818, 35253837). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34774 Product name: Recombinant human PCARE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-150 aa of NM_001029883 Sequence: LVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSSQLNKSQSHMAKDIPFKTQGSHGSQGADFSGDESEESSTQDTSKWKRTAK Predict reactive species Full Name: chromosome 2 open reading frame 71 Calculated Molecular Weight: 140 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_001029883 Gene Symbol: PCARE Gene ID (NCBI): 388939 RRID: AB_3669889 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NGG8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924