Iright
BRAND / VENDOR: Proteintech

Proteintech, 31189-1-AP, UBAP1L Polyclonal antibody

CATALOG NUMBER: 31189-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UBAP1L (31189-1-AP) by Proteintech is a Polyclonal antibody targeting UBAP1L in WB, ELISA applications with reactivity to human samples 31189-1-AP targets UBAP1L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information UBAP1L, is a fairly unknown protein. It is predicted to enable ubiquitin binding activity and is believed to be involved in the ubiquitin-dependent protein catabolic process through the multivesicular body sorting pathway. It is also predicted to be part of endosomal sorting complexes required for transport. UBAP1L contains a SOUBA domain, which begins at amino acid residue 269 and extends to the C terminus of the protein. This domain is similar to the one found in UBAP1, where it is known to interact with ubiquitin (PMID: 38293907). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34816 Product name: Recombinant human UBAP1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-381 aa of NM_001163692 Sequence: TTIRDPEAGHQERPEEEGEDEAEASSGSEEEPAPSSLQPGSPASPGPGRRLCSLDVLRGVRLELAGARRRLSEGKLVSRPRALLHGLRGHRALSLCPSPAQSPRSASPPGPAPQHPAAPASPPRPSTAGAIPPLRSHKPTVASLSPYTCLPPLGGAPQPLNPHKSHPDTAADLLSALSQEEQDLIGPVVALGYPLRRAIIALQKTGRQSLSQFLSYLSACDRLLRQGYEEGLVDEAMEMFQFSESQAGEFLRLWEQFSDMGFQQDRIKEVLLVHGNRREQALEELVACAQ Predict reactive species Full Name: similar to ubiquitin-associated protein 1 (predicted) Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: NM_001163692 Gene Symbol: LOC390595 Gene ID (NCBI): 390595 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: F5GYI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924