Iright
BRAND / VENDOR: Proteintech

Proteintech, 31195-1-AP, RAB44 Polyclonal antibody

CATALOG NUMBER: 31195-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB44 (31195-1-AP) by Proteintech is a Polyclonal antibody targeting RAB44 in WB, ELISA applications with reactivity to human samples 31195-1-AP targets RAB44 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Rab44 is a member of the large Rab GTPase family, encoding an N-terminal EF-hand domain, a coiled-coil domain and a C-terminal Rab GTPase domain. It is highly expressed in immune-related cells such as mast cells, macrophages, osteoclasts and granulocyte lineage cells in the bone marrow. In mouse mast cells, Rab44 is expressed as two isoforms, the long and short forms with molecular masses of 180 kDa and 110 kDa (PMID: 33641252). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35126 Product name: Recombinant human RAB44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_001257357 Sequence: METGQRTSRKVRKLGSNRRRQTREPADGEGAAVAPEPESWSSQAAAELQAFFQDCGAKERGFVTREDLAVAKFSFLGSKEESEMIFDWVDVERKGHLSLEEFSSGLKNIFGSSQSPHRLRRRKPLPSKRVSATTSFPALEEADAEEKEAF Predict reactive species Full Name: RAB44, member RAS oncogene family Calculated Molecular Weight: 111 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: NM_001257357 Gene Symbol: RAB44 Gene ID (NCBI): 401258 RRID: AB_3669894 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z6P3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924