Proteintech, 31197-1-AP, Keap1 Polyclonal antibody

Size: 20ul / 150ul The Keap1 (31197-1-AP) by Proteintech is a Polyclonal antibody targeting Keap1 in WB, ELISA applications with reactivity to mouse, rat samples 31197-1-AP targets Keap1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information KEAP1 (Kelch-like ECH-associated protein 1) is a critical regulatory protein that plays a pivotal role in the cellular response to oxidative stress. It is best known for its function as a negative regulator of the Nrf2 (NF-E2-related factor 2) pathway, which is essential for maintaining cellular redox homeostasis. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35035 Product name: Recombinant mouse Keap1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-624 aa of NM_001110305 Sequence: RNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC Predict reactive species Full Name: kelch-like ECH-associated protein 1 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 60-64 kDa GenBank Accession Number: NM_001110305 Gene Symbol: Keap1 Gene ID (NCBI): 50868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Z2X8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.